Home|über BioLogo|Bestellen|Kontakt|Hilfe|News|AGB|Sitemap |English
   Registrieren
line
logo

Antikörper - rekombinante Proteine - Färbereagenzien


für Biologie und Medizin - Beratung · Entwicklung · Herstellung · Vertrieb
line
Produktsuche:
line
Produkte:
line
AGE
line
BioPrime Antikörper
line
BioPrime Färbereagenzien
line
BioPrime Zubehör
line
ECM
line
ELISA
line
Enzyme
line
Forschung
line
Proteine & Peptide
line
VECTOR Reagenzien
line
  Datenblatt ausdrucken   warenkorb_large (1K) in den Warenkorb legen

Produkte > Forschung

Art.-Nr.


CDX002: CDX2, 1C7



Preis: 360 € / 1 ml

Monoklonale Antikörper

Herkunft:Maus
 
Isotyp:IgG mix kappa
 
Klon:1C7
 
Form:konz.
 
Menge:1 ml
 
Konzentration:50 µg/ml
 
Arbeitskonzentration:3 µg/ml
 
Präsentation:Gereinigtes IgG in PBS, pH 7.2, 0,09% Na-Azid
 
Immunogen:Rekombinantes humanes CDX2 AS 1-314 mit GST-Tag. MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLEL
 
Spezifität:CDX2, human
 
Artspezifität:Mensch
 
Allgemeines:CDX2 ist ein Homeobox-Gen das für einen intestinalen Transkriptionsfaktor codiert, der in Zellkernen intestinaler Epithelzellen exprimiert wird, insbesondere im Rectum und Duodenum. Es wird in primären colorektalen Karzinomen exprimiert ebenso wie in deren Metastasen. Es wurde auch in intestinalen Metaplasie des Magens identifiziert und in intestinalen Magenkarzinomen. CDX2 wird nicht in normaler Magenschleimhaut gebildet.
 
Spezielle Eigenschaften:Der Antikörper gegen CDX2 ist gut geeignet zum Nachweis des Proteinprodukts in Zellkernen und Gewebeextrakten.
 
Positivkontrolle:Colonkarzinom
 
Vorbehandlung:Formalin-fixiertes Gewebe erfordert eine Hitzedemaskierung mit Citratpuffer pH 6 (Art.-Nr. DE000) 15-30 min bei 100°C, danach 20 min abkühlen, bis RT erreicht ist. Blockierung der endogenen Oxidoreduktasen (H2O2 1%ig 30 min), der unspezifischen Proteinbindung (SeaBlock Blockierungspuffer Art. Nr. PU083) und evtl. Blockierung von endogenem Biotin (Avidin/Biotin Blocking Kit Ref. SP2001) zur Vermeidung von unspezifischem Hintergrund.
 
Anwendung:IHC (Gefrier- oder Paraffinschnitte), Western Blot, ELISA an Gewebelysaten oder Zelllysaten
 
Sekundärreagenzien:Anti-Maus IgG-Konjugate, biotinyliert (Art.-Nr. BA-2000 od. BA-2001), HRPO-konjugiert (Art.-Nr. PI-2000) FITC-markiert (Art.-Nr. FI-2000 oder FI-2001) oder VECTOR ImmPress Maus IgG Polymerkit (Art.-Nr. MP-7402)
 
Lagerung:2-8°C
 

Literatur:
1. Barbareschi M., Murer B., Colby T.V., Chilosi M., Macri E., Loda M., Coglioni C. (2003) CDX-2 homeobox gene expression is a reliable marker of colorectal adenocarcinoma metastases to the lungs. Am J. Surg. Pathol. 27; 141-149

2. Werling R.W. Yaziji H., Bacchi C.E., Gown A.M. (2003) CDX2, a highly sensitive and specific marker of adenocarcinomas of intestinal origin: An immunohistochemical survey of 476 primary and metastatic carcinomas. Am. J. Surg. Pathol. 27; 303-310.



Hinweise
Das Konservierungsmittel Natriumazid ist gesundheitsgefährdend und sollte trotz der niedrigen Konzentration sorgfältig gehandhabt und entsorgt werden.

BIOLOGO Antikörper sind Forschungsreagenzien für In-vitro-Untersuchungen. Sie sind nicht für die klinische Diagnostik bestimmt. Eine Haftung für nicht bestimmungsgemäßen Gebrauch wird vom Hersteller ausgeschlossen.

 Datenblatt ausdrucken


» zur Produktliste Forschung

BioLogo | Steindamm 1 G-H | 24119 Kronshagen | Telefon +49 (0)431.5842 801 | Fax +49 (0)431.5842 803 | info@biologo.de