Home|über BioLogo|Bestellen|Kontakt|Hilfe|News|AGB|Sitemap |English

Antikörper - rekombinante Proteine - Färbereagenzien

für Biologie und Medizin - Beratung · Entwicklung · Herstellung · Vertrieb
BioPrime Antikörper
BioPrime Färbereagenzien
BioPrime Zubehör
Proteine & Peptide
VECTOR Reagenzien
  Datenblatt ausdrucken   warenkorb_large (1K) in den Warenkorb legen

Produkte > Forschung


DEF02-MC-10: Beta-Defensin 2 (4-41) HBD-2

Preis: 190 € / 10 µg

Monoklonaler Antikörper

Menge:10 µg
Rekonstitution:100 µl steriles aqua dest.
Konzentration:1 mg/ml nach Rekonstitution
Arbeitskonzentration:WB 5 µg/ml, IHC(P) 0,5-2 µg/ml
Präsentation:Protein-G gereinigter Antikörper aus Zellkulturüberstand in TRIS-Puffer pH 7.4, lyophilisiert
Immunogen:Synthetisches humanes ß-Defensin 2 (AS 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Spezifität:Humanes ß-Defensin 2, keine Kreuzreaktivität mit Alpha-Defensinen (HNP) und anderen humanen ß-Defensinen
Allgemeines:Humane Defensine sind Cys-reiche antimikrobielle Peptide, die spezifisch gegen Gram-negative Bakterien gerichtet sind. Ursprünglich aus Hämolysaten isoliert, findet man diese Peptide auch auf der Zelloberfläche von Epithelien des Urogenitaltrakts, der Lunge, Haut und Trachea. In Leukozyten werden die Defensine in Granula gespeichert und bei Bedarf in Phagolysosomen freigesetzt, um eingeschlossene Mikroorganismen unschädlich zu machen. Es wurden bisher 6 verschiedene Alpha-Defensine charakterisiert und 6 Beta-Defensine. Zwischen Alpha- und Beta-Defensinen besteht nur eine geringe AS-Homologie. Zwischen Beta-Defensin-1 und Beta-Defensin-2 findet man eine 34%ige Sequenzhomologie.
Spezielle Eigenschaften:Der Antikörper ist gut geeignet, um ß-Defensin 2 in Geweben und Körperflüssigkeiten bzw. Zellkulturen nachzuweisen.
Vorbehandlung:Immunhistochemie an Paraffinschnitten benötigt eine Antigendemaskierung z..B. mit Citratpuffer pH 6 (Demaskierunslösung C, Art.-Nr. DE000) oder TRIS/EDTA/Citrat (Demaskierungslösung T, Art.-Nr. DE005)
Anwendung:Der Antikörper ist verwendbar für Western Blot (1:200-1:2000, ECL-Technik) , ELISA, Immunhistochemie 0,5 µg/ml-2 µg/ml abhängig vom Detektionssystem.
Sekundärreagenzien:Als Sekundärsystem in der Immunhistochemie empfehlen wir unsere Universal-Färbekits DAB und AEC (Art.Nr. DA005 und AE005) oder einen VECTASTAIN ABC Maus IgG Kit (Art.-Nr. PK-6102) oder den ImmPress Kit Maus IgG (Art.-Nr. MP-7402) in Kombination mit einem passenden Substrat (DA002 oder AE002).

1. Harder J., Bartels J., Christophers E., and J.-M. Schröder (1997) Antibacterial peptide specific for Gram-negative Bacteria / also effective for Candida albicans. Nature 387; 861ff

2. Hiratsuka T., Nakazato M., Date Y., Ashitani J., Minematsu T, Chino N., and S. Matsukura (1998) Biochem. Biophys. Res. Comm. (Pharmacol.) 249; 943 ff

3. Langhorst J, Junge A, Rueffer A, Wehkamp J, Foell D, Michalsen A, Musial F, and Dobos GJ (2009) Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome. Am. J. Gastroenterol. 104(2): 404-410.

 Datenblatt ausdrucken

» zur Produktliste Forschung

BioLogo | Steindamm 1 G-H | 24119 Kronshagen | Telefon +49 (0)431.5842 801 | Fax +49 (0)431.5842 803 | info@biologo.de