Home|über BioLogo|Bestellen|Kontakt|Hilfe|News|AGB|Sitemap |English
   Registrieren
line
logo

Antikörper - rekombinante Proteine - Färbereagenzien


für Biologie und Medizin - Beratung · Entwicklung · Herstellung · Vertrieb
line
Produktsuche:
line
Produkte:
line
AGE
line
BioPrime Antikörper
line
BioPrime Färbereagenzien
line
BioPrime Zubehör
line
ECM
line
ELISA
line
Enzyme
line
Forschung
line
Proteine & Peptide
line
VECTOR Reagenzien
line
  Datenblatt ausdrucken   warenkorb_large (1K) in den Warenkorb legen

Produkte > Forschung

Art.-Nr.


DEF02-MC-100: Beta-Defensin 2 (4-41) HBD-2



Preis: 540 € / 100 µg

Monoklonaler Antikörper

Herkunft:Maus
 
Isotyp:IgG1
 
Klon:L12-4C-C2
 
Form:lyophil.
 
Menge:100 µg
 
Rekonstitution:100 µl steriles aqua dest.
 
Konzentration:1 mg/ml nach Rekonstitution
 
Arbeitskonzentration:WB 5 µg/ml, IHC(P) 0,5-2 µg/ml
 
Präsentation:Protein-G gereinigter Antikörper aus Zellkulturüberstand in TRIS-Puffer pH 7.4, lyophilisiert
 
Immunogen:Synthetisches humanes ß-Defensin 2 (AS 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
 
Spezifität:Humanes ß-Defensin 2, keine Kreuzreaktivität mit Alpha-Defensinen (HNP) und anderen humanen ß-Defensinen
 
Artspezifität:Mensch
 
Allgemeines:Humane Defensine sind Cys-reiche antimikrobielle Peptide, die spezifisch gegen Gram-negative Bakterien gerichtet sind. Ursprünglich aus Hämolysaten isoliert, findet man diese Peptide auch auf der Zelloberfläche von Epithelien des Urogenitaltrakts, der Lunge, Haut und Trachea. In Leukozyten werden die Defensine in Granula gespeichert und bei Bedarf in Phagolysosomen freigesetzt, um eingeschlossene Mikroorganismen unschädlich zu machen. Es wurden bisher 6 verschiedene Alpha-Defensine charakterisiert und 6 Beta-Defensine. Zwischen Alpha- und Beta-Defensinen besteht nur eine geringe AS-Homologie. Zwischen Beta-Defensin-1 und Beta-Defensin-2 findet man eine 34%ige Sequenzhomologie.
 
Spezielle Eigenschaften:Der Antikörper ist gut geeignet, um ß-Defensin 2 in Geweben und Körperflüssigkeiten bzw. Zellkulturen nachzuweisen.
 
Positivkontrolle:Haut
 
Vorbehandlung:Immunhistochemie an Paraffinschnitten benötigt eine Antigendemaskierung z..B. mit Citratpuffer pH 6 (Demaskierunslösung C, Art.-Nr. DE000) oder TRIS/EDTA/Citrat (Demaskierungslösung T, Art.-Nr. DE005)
 
Anwendung:Der Antikörper ist verwendbar für Western Blot (1:200-1:2000, ECL-Technik) , ELISA, Immunhistochemie 0,5 µg/ml-2 µg/ml abhängig vom Detektionssystem.
 
Sekundärreagenzien:Als Sekundärsystem in der Immunhistochemie empfehlen wir unsere Universal-Färbekits DAB und AEC (Art.Nr. DA005 und AE005) oder einen VECTASTAIN ABC Maus IgG Kit (Art.-Nr. PK-6102) oder den ImmPress Kit Maus IgG (Art.-Nr. MP-7402) in Kombination mit einem passenden Substrat (DA002 oder AE002).
 
Lagerung:-20°C
 

Literatur:
1. Harder J., Bartels J., Christophers E., and J.-M. Schröder (1997) Antibacterial peptide specific for Gram-negative Bacteria / also effective for Candida albicans. Nature 387; 861ff


2. Hiratsuka T., Nakazato M., Date Y., Ashitani J., Minematsu T, Chino N., and S. Matsukura (1998) Biochem. Biophys. Res. Comm. (Pharmacol.) 249; 943 ff


3. Langhorst J, Junge A, Rueffer A, Wehkamp J, Foell D, Michalsen A, Musial F, and Dobos GJ (2009) Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome. Am. J. Gastroenterol. 104(2): 404-410.




 Datenblatt ausdrucken


» zur Produktliste Forschung

BioLogo | Steindamm 1 G-H | 24119 Kronshagen | Telefon +49 (0)431.5842 801 | Fax +49 (0)431.5842 803 | info@biologo.de