Home|über BioLogo|Bestellen|Kontakt|Hilfe|News|AGB|Sitemap |English
   Registrieren
line
logo

Antikörper - rekombinante Proteine - Färbereagenzien


für Biologie und Medizin - Beratung · Entwicklung · Herstellung · Vertrieb
line
Produktsuche:
line
Produkte:
line
AGE
line
BioPrime Antikörper
line
BioPrime Färbereagenzien
line
BioPrime Zubehör
line
ECM
line
ELISA
line
Enzyme
line
Forschung
line
Proteine & Peptide
line
VECTOR Reagenzien
line
  Datenblatt ausdrucken   warenkorb_large (1K) in den Warenkorb legen

Produkte > Forschung

Art.-Nr.


DOG001: DOG1 (Discovered on GIST 1)



Preis: 360 € / 1 ml

Monoklonale Antikörper

Herkunft:Maus
 
Isotyp:IgG
 
Klon:DOG1.1
 
Form:konz.
 
Menge:1 ml
 
Konzentration:50 µg/ml
 
Arbeitskonzentration:1-2 µg/ml
 

GIST Paraffinschnitte Membran-Färbung mit DOG1.1, Anti -Maus-IgG-HRP-Polymer und DAB



GIST Paraffinschnitte zytoplasmatische Färbung mit DOG1.1, Anti -Maus-IgG-HRP-Polymer und DAB


Präsentation:Protein G affinitätsgereinigter Antikörper aus Ascites in stabilisiertem Puffer, enthält BSA und 0,09% Natriumazid als Bakteriostaticum
 
Immunogen:Synthetisches Peptid (FLJ34272) humanes DOG1 Sequenz: MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL .
 
Spezifität:Humanes DOG1, gastrointestinale Stroma-Tumore (GIST)
 
Artspezifität:Mensch, Huhn, Hamster, Ratte
 
Allgemeines:Das DOG1 (Discovered on GIST 1) Gen kodiert für ein Zelloberflächen-Protein unbekannter Funktion, das speziell in gastrointestinalen Stromatumoren (GIST) exprimiert wird. Die Expression in GIST ist unabhängig von der Expression von c-kit und PDGFR-alpha-Mutationen. Dadurch kann mit DOG1 eine höhere Anzahl von GIST (87%) nachweisen als die herkömmlichen Marker CD117 (c-kit)(74%) und CD34, die bei der Differentialdiagnose von gastrointestinalen Tumoren eingesetzt werden (Espinosa et al., 2008). DOG1 Immunreaktivität war 79% bei GIST mit PDGFRa- Mutationen, während nur 9% von diesen CD117-positiv waren. Deshalb könnte die Diagnose mit DOG1 auch Konsequenzen für die Therapie mit Imatinib (Glivec®), einem Tyrosinkinaseinhibitor haben, der bei CML und GIST eingesetzt wird.
 
Spezielle Eigenschaften:Der Antikörper ist gut geeignet, um GIST in Gewebeschnitten (Magen, Darm und verschiedenen Metastasen) nachzuweisen. Gewöhnlich wird die Zellmembran gefärbt, aber es wurden auch zytoplasmatische Färbungen gefunden, insbesondere bei Spindelzell-GIST.
 
Positivkontrolle:GIST
 
Vorbehandlung:Zur Vorbehandlung von Paraffinschnitten wird Demaskierungslösung E (TRIS/EDTA pH 9 Art. Nr. DE006) empfohlen.
 
Anwendung:IHC (C,P)
 
Sekundärreagenzien:Als Sekundärreagenzien empfehlen wir die Anwendung von Immunperoxidase-Systemen, wie z.B. unser Universal-Färbesystem DAB (Art.-Nr. DA005) oder AEC (Art.-Nr. AE005), aber auch ABC- oder Polymersysteme (z.B. VECTOR ImmPress Maus IgG, Art. No. MP-7402) sind geeignet.
 
Lagerung:2-8°C
 
Expression:
Die Expression von DOG1 kann auf der Membran und zytoplasmatisch erfolgen.
 

Literatur:
1. West R.B., et al. (2004) The novel marker , DOG1, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFRA mutation. Am J. Pathol. 165(1) 107-113.

2. Espinosa I., et al.(2008) A novel monoclonal antibody against DOG1 is a sensitive and specific marker for gastrointestinal stromal tumors. Am J. Surg. Pathol 32(2)210-218

3. Liegl B., et al. (2009) Monoclonal antibody DOG1.1 shows higher sensitivity than KIT in the diagnosis of gastrointestinal stromal tumors, including unusual subtypes. Am. J. Surg. Pathol 33(3) 437-446.



Hinweise
Das Konservierungsmittel Natriumazid ist gesundheitsgefährdend und sollte trotz der niedrigen Konzentration sorgfältig gehandhabt und entsorgt werden.

BIOLOGO Antikörper sind Forschungsreagenzien für In-vitro-Untersuchungen. Sie sind nicht für die klinische Diagnostik bestimmt. Eine Haftung für nicht bestimmungsgemäßen Gebrauch wird vom Hersteller ausgeschlossen.

 Datenblatt ausdrucken


» zur Produktliste Forschung

BioLogo | Steindamm 1 G-H | 24119 Kronshagen | Telefon +49 (0)431.5842 801 | Fax +49 (0)431.5842 803 | info@biologo.de